PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT04762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 340aa    MW: 37807.5 Da    PI: 8.7176
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT04762genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.22.4e-104890145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     r+ WT  Ed  l+++++ +G++ W+ Iar +   R+++ +k+ ++
         EMT04762 48 RKIWTDAEDMDLIELHQTWGNR-WSVIARLLS-DRSENAVKNNYN 90
                     567*******************.*********.********9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-123698IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-134295IPR009057Homeodomain-like
PROSITE profilePS500908.3274393IPR017877Myb-like domain
SMARTSM007173.2E-94795IPR001005SANT/Myb domain
PfamPF002497.2E-95090IPR001005SANT/Myb domain
CDDcd001678.23E-85193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGIILARRLT RLSSSASSDP ICMTQLGRFG RPKITLKQHK ICQQQNKRKI WTDAEDMDLI  60
ELHQTWGNRW SVIARLLSDR SENAVKNNYN ATKRSLNAKR QLKKRNSKQP PPSQLSLLAE  120
YIRSLEPHTG PPAETPLVSP PLYHDQEHGE KMGMARRDAT IIIAPTTQAH QTYPNPAMTG  180
MYYHPNPTNM QYWAPDLNVV DGQNKGYSHY IPPNAHLNHF LSYGLLPTQM VSEQDIQQAV  240
NASMNMSAFT GQHTLPTSNL KAVAEMHHES SANNQLGNMG GGASDWSYYY SMDAACPSGS  300
AGGSGSGSDP DDIDVVQMAS SEFATQDREV VTLSRLPRFK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8BP850.0M8BP85_AEGTA; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-15myb domain protein 98